A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10094 |
| Swiss-prot Accession number | Q9U5D2 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 2 precursor (Pej-SGP-II) [Contains:CHH precursor-related peptide 2 (CPRP 2); Crustacean hyperglycemichormone 2 (CHH 2)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 120 Amino acids |
| Molecular weight | 13467 |
| References | 1 Ohira T., Watanabe T., Aida K., Nagasawa H.; "Crustacean hyperglycemic hormone of kuruma prawn Penaeus japonicus."; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 9210164 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 2 |
| Mature Hormone Sequence | SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (47-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10095 |
| Swiss-prot Accession number | Q94676 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 3 precursor (Pej-SGP-III) [Contains:CHH precursor-related peptide 3 (CPRP 3); Crustacean hyperglycemichormone 3 (CHH 3)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released (By similarity) |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 117 Amino acids |
| Molecular weight | 12954 |
| References | 1 PubMed abstract 9116871 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 3 |
| Mature Hormone Sequence | SLFDPACTGIYDRQLLRKLGRLCDDCYNVFREPKVATGCRSNCYHNLIFLDCLEYLIPSHLQEEHMAAMQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (44-115) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10571 |
| Swiss-prot Accession number | O15980 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 1 precursor (Pej-SGP-I) [Contains:CHH precursor-related peptide 1 (CPRP 1); Crustacean hyperglycemichormone 1 (CHH 1)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 120 Amino acids |
| Molecular weight | 13298 |
| References | 1 Ohira T., Watanabe T., Nagasawa H., Aida K.; "Molecular cloning of cDNAs encoding four crustacean hyperglycemichormones and a molt-inhibiting hormone from the kuruma prawn Penaeusjaponicus."; (In) Proceedings of the XIII international congress of comparativeendocrinology, pp.83-86, Yokohama (1998).
2 PubMed abstract 9210164 3 Yang W.-J., Aida K., Nagasawa H.; "Amino acid sequences of a hyperglycaemic hormone and its relatedpeptides from the kuruma prawn, Penaeus japonicus."; Aquaculture 135:205-212(1995). |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 1 |
| Mature Hormone Sequence | SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (47-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10576 |
| Swiss-prot Accession number | O15981 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 5 precursor (Pej-SGP-V) [Contains:CHH precursor-related peptide 5 (CPRP 5); Crustacean hyperglycemichormone 5 (CHH 5)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 125 Amino acids |
| Molecular weight | 13979 |
| References | 1 Ohira T., Watanabe T., Nagasawa H., Aida K.; "Molecular cloning of cDNAs encoding four crustacean hyperglycemichormones and a molt-inhibiting hormone from the kuruma prawn Penaeusjaponicus."; (In) Proceedings of the XIII international congress of comparativeendocrinology, pp.83-86, Yokohama (1998).
2 PubMed abstract 9210164 3 Yang W.-J., Aida K., Nagasawa H.; "Amino acid sequences of a hyperglycaemic hormone and its relatedpeptides from the kuruma prawn, Penaeus japonicus."; Aquaculture 135:205-212(1995). |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 5 |
| Mature Hormone Sequence | LVFDPSCAGVYDRVLLGKLNRLCDDCYNVFREPNVATECRSNCFYNLAFVQCLEYLMPPSLHEEYQANVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (52-123) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10578 |
| Swiss-prot Accession number | P81700 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormone 6 (Pej-SGP-VI). |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 72 Amino acids |
| Molecular weight | 8312 |
| References | 1 PubMed abstract 9210164 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 6 |
| Mature Hormone Sequence | LVFDPSCAGVYDRVLLGKLNRLCDDCYNVFREPNVATECRSNCFYNLAFVQCLEYLLPPSLHEEYQANVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (1-72) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10579 |
| Swiss-prot Accession number | O15982 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 7 precursor (Pej-SGP-VII) [Contains:CHH precursor-related peptide 7 (CPRP 7); Crustacean hyperglycemichormone 7 (CHH 7)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 122 Amino acids |
| Molecular weight | 13583 |
| References | 1 Ohira T., Watanabe T., Nagasawa H., Aida K.; "Molecular cloning of cDNAs encoding four crustacean hyperglycemichormones and a molt-inhibiting hormone from the kuruma prawn Penaeusjaponicus."; (In) Proceedings of the XIII international congress of comparativeendocrinology, pp.83-86, Yokohama (1998).
|
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormones 7 |
| Mature Hormone Sequence | AAFDPSCTGVYDRELLGRLSRLCDDCYNVFREPKVAMECRSNCFFNPAFVQCLEYLIPAELHEEYQALVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (49-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10650 |
| Swiss-prot Accession number | P55847 (Sequence in FASTA format) |
| Description | Molt-inhibiting hormone precursor (MIH) (PeJ-SGP-IV). |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
| Post translational modification | N/A |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity |
| Protein Length | 105 Amino acids |
| Molecular weight | 12150 |
| References | 1 PubMed abstract 9450390 2 PubMed abstract 8801521 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Molt-inhibiting hormone |
| Mature Hormone Sequence | SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ |
| Position of mature hormone in Pre-Hormone protein | 77 Residues from position (29-105) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | 1J0T |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |